PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g68800.1.p
Common NameBRADI_1g68800, LOC100828563
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 254aa    MW: 27268.8 Da    PI: 8.3042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g68800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.6e-152675348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                       W++eEd ll + v+++G  +W+++a+ +     ++Rt k+c++rw+++l
  Bradi1g68800.1.p 26 MWSEEEDRLLRQQVRLHGAQSWDKVAEALEqalpNNRTSKSCRLRWYQHL 75
                      5**********************************************996 PP

2Myb_DNA-binding46.77.1e-1584126347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T +Ed+l++++ + +G++ W+tIa  +  gRt++ +k+rw+++
  Bradi1g68800.1.p  84 PFTRDEDKLIIHYQAIHGNR-WSTIAGFLS-GRTDNAVKNRWNSV 126
                       89******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2631979IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-162378IPR009057Homeodomain-like
SMARTSM007174.2E-142377IPR001005SANT/Myb domain
SuperFamilySSF466899.52E-2823123IPR009057Homeodomain-like
PfamPF002492.8E-142675IPR001005SANT/Myb domain
CDDcd001671.27E-132775No hitNo description
SMARTSM007174.6E-1281129IPR001005SANT/Myb domain
PfamPF002492.4E-1284127IPR001005SANT/Myb domain
CDDcd001672.01E-1184127No hitNo description
PROSITE profilePS5129415.12584131IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-1884128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MASTPGTSGS GGGGHPPHRH VSKKTMWSEE EDRLLRQQVR LHGAQSWDKV AEALEQALPN  60
NRTSKSCRLR WYQHLDPKVD AVKPFTRDED KLIIHYQAIH GNRWSTIAGF LSGRTDNAVK  120
NRWNSVLKCH ARASSSAERP RAPCAAARNA ACAELTQGCL SLFPLASGDV RQHGSRPSPG  180
VFMPLASEED VSDVETGACL ELFPMAPGDI RSNAGAAASK GMSCGAGDPL TELRLGSAAV  240
VVFDVMPLQA YPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-212712810105B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561848.10.0PREDICTED: transcription factor MYB23-like
TrEMBLI1H7P10.0I1H7P1_BRADI; Uncharacterized protein
STRINGBRADI1G68800.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-27myb domain protein 77